19,364 Free Images of 1st

cc-zerophotographs by leonhard lenza history of the birds of new zealand by bullercitytrafficsidewalkpavementmygruni 1st may demonstration berlin 2021street scenecity life
Roschinsky 1st passage
self-published workvehicle
NMW 1st floor
self-published workcc-zero
Jerusalem Walls 1st Temple Period
self-published workcc-zero
Control changes at Combat Outpost Power DVIDS178467
1st cavalry division (united states)army
Sir Alexander Macdonald, 1744 - 1795. 9th Baronet of Sleat and 1st Baron Macdonald of Slate, George Chalmers, 1772
18th-century portrait paintings in the scottish national gallerygeorge chalmers
A walk by the sea shore. (BM 1868,0808.9448 1)
lithographs in the british museumarthur wellesley
Benjamin Disraeli, Earl of Beaconsfield (cropped)
1st earl of beaconsfieldcabinet card
Frances Hamilton (1795-1860), by Thomas Lawrence
portrait drawings by thomas lawrencejohn hamilton
Il Dolore, statua sepolcrale di Emilio Marsili
1895 l'illustrazione popolare1st venice biennale
Falls Church, July 1st, 1861, Outpost LCCN2004660599
drawings (documentary) collection in the library of congressdrawings by alfred waud
Falls Church, July 1st, 1861, Outpost LCCN2004660599
drawings (documentary) collection in the library of congressdrawings by alfred waud
History of the birds of NZ 1st ed p214-2
a history of the birds of new zealand by bullerthinornis novaeseelandiae (illustrations)
History of the birds of NZ 1st ed p010-2
a history of the birds of new zealand by bullercircus approximans (illustrations)
History of the birds of NZ 1st ed p252-2
a history of the birds of new zealand by bullerspatula rhynchotis (illustrations)
History of the birds of NZ 1st ed p188-2
a history of the birds of new zealand by bullerporphyrio hochstetteri (illustrations)
History of the birds of NZ 1st ed p358-2
a history of the birds of new zealand by bullerapteryx mantelli (illustrations)
Dragoon Guards in Second Opium War
the illustrated london news 1860battle of palikao
History of the birds of NZ 1st ed p086-2
a history of the birds of new zealand by bullerprosthemadera novaeseelandiae (illustrations)
George Monck, 1st Duke of Albemarle by Samuel Cooper
portrait paintings in the national portrait gallerylondon
Lord Strathcona (HS85-10-19860)
1st baron strathcona and mount royaldonald smith
Portrait of Thomas, Lord Longford P5411
portrait paintings in the national gallery of irelandthomas pakenham
Battle of the Nile, Augt. 1st 1798 RMG PU5565
drawings and watercolours of the royal museums greenwichprinting
Battle of Atbara 1
1st earl kitchenerherbert kitchener
Caroline Fludyer, by Thomas Gainsborough
female portraits by thomas gainsborough1st baronet
Douce Apocalypse - Bodleian Ms180 - p.013 First Horseman
douce apocalypse - bodleian ms1801st horseman of the apocalypse
Death of Col. John J. Hardin- Of the 1st regiment Illinois volunteers LCCN91793588
battle of buena vistagraphic art
George Macartney, 1st Earl Macartney; Sir George Leonard Staunton, 1st Bt by Lemuel Francis Abbott
1st baronetlondon
Kenton devon texture
horsescity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 72
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 54
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 78
peoplecity
Revolutionary 1st may demonstration Berlin 2021 269
vehiclecity
Revolutionary 1st may demonstration Berlin 2021 268
vehiclecar
MyGruni 1st may demonstration Berlin 2021 Grunewald to Hermannplatz 98
trafficlight
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 77
peoplecity
US Navy 041023-N-9693M-004 U.S. Naval Academy Midshipman 1st Class Kyle Eckel is tackled by Rice University defenders on a rushing attempt in the 1st quarter
sport2004
US Navy 100512-N-0869H-049 Information Systems Technician 1st Class Matt Perez and Hospital Corpsman 1st Class Devin McConnell prepare pipe for conduit installation during a Habitat for Humanity building project
washingtonspokane
Perfume Bottle, Eastern Mediterranean, 100 BC - 200 AD, free-blown glass, rolled and flared rim - Huntington Museum of Art - DSC04829
1st-century bc glassware in the united statesself-published work
SirJohnAcland 1stBaronet ByRobertWalker
robert walker (painter)1st baronet
William Stanhope, 1st Earl of Harrington P6544
prints in the national gallery of irelandmaster of the carpets
Heaphy Duke of Wellington BomannMuseum@20150903
paintings in the bomann-museumarthur wellesley
Speaker Abercromby by John Jackson
1st baron dunfermlinejames abercromby
William Waldorf Astor (1848–1919), 1st Viscount Astor
paintings by hubert von herkomerwilliam waldorf astor
Portrait of John Duke of Malborough (4671383)
national library of wales portrait archivejohn churchill
Portrait of Sir Colin Campbell (4671337)
national library of wales portrait archivecolin campbell
Portrait of the Duke of Wellington, K.G. (4674636)
national library of wales portrait archivearthur wellesley
The battle of Manila, fought on Sunday morning, May 1st 1898 LCCN2003688777
media needing categories as of 22 january 2019
The battle of Manila, fought on Sunday morning, May 1st 1898 LCCN2003688777
media needing categories as of 11 may 2019
AlanGardner
paintings by william beecheylondon
Esposizione Internazionale di Belle Arti a Venezia la folla all’ingresso
1895 l'illustrazione popolare1st venice biennale
Lord Strathcona (HS85-10-19862)
1st baron strathcona and mount royaldonald smith
Lord Strathcona (HS85-10-19864)
1st baron strathcona and mount royaldonald smith
LéonGambetta
lisbon regicideléon gambetta
History of the birds of NZ 1st ed p164-2
a history of the birds of new zealand by bullergallirallus australis (illustrations)
History of the birds of NZ 1st ed p368-2
a history of the birds of new zealand by bullerapteryx owenii (illustrations)
History of the birds of NZ 1st ed p240-2
a history of the birds of new zealand by bullertadorna variegata (illustrations)
History of the birds of NZ 1st ed p156-2
a history of the birds of new zealand by bullerhemiphaga novaeseelandiae (illustrations)
History of the birds of NZ 1st ed p338
a history of the birds of new zealand by bullerphalacrocoracidae illustrations
Funeral 1st Mass Arty Harrisons landing LCCN2004660814
drawings (documentary) collection in the library of congressdrawings by alfred waud
Arthur-Wellesley-1st-Duke-of-Wellington (cropped)
duke of wellington (jackson)conservative party (uk)
Billy Hughes and David Lloyd George
1st earl lloyd-george of dwyfordavid lloyd george
MaryMorrice AntonyHouse Cornwall
1st baronet3rd baronet
Olympic & Titanic 1st Class Pool Drawing
belfast1910
Thomas Denman, 1st Baron Denman by Sir Martin Archer Shee crop
details of paintingsmartin archer shee
US Navy 051105-N-9693M-009 ) U.S. Naval Academy Midshipman 1st Class Marco Nelson (29) crosses the goal line to score in the 1st quarter of play
sport2005
US Navy 101214-N-7589W-060 Equipment Operator 1st Class Jimmy Peterson, left, Utilitiesman 1st Class Carlos Sanchez and Cpl. Paul Fuit
naval mobile construction battalion 28ventanilla district
US Navy 100118-N-1522S-498 he Military Sealift Command maritime prepositioning ship USNS 1st Lt. Jack Lummus (T-AK-3011)
florida1986
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 65
peoplecity
MyGruni 1st may demonstration Berlin 2021 Grunewald to Hermannplatz 121
peoplecity
MyGruni 1st may demonstration Berlin 2021 Grunewald to Hermannplatz 115
peoplecity
MyGruni 1st may demonstration Berlin 2021 Grunewald to Hermannplatz 116
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 15
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 38
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 30
peoplecity
MyGruni 1st may demonstration Berlin 2021 Hermannplatz to Großer Stern 61
vehiclecity
Revolutionary 1st may demonstration Berlin 2021 188
trafficcity
Arretine bowl, Corchiano, Italy, c. 1st century AD, terracotta - Spurlock Museum, UIUC - DSC05839
self-published workfood
Francis Bassett, 1st Baron of Dunstanville, Pompeo Batoni, 1778
male portraits by pompeo batoniclassicism
Alice, Countess of Shipbrook by Francis Cotes
ermine (clothing) in artfrancis cotes
Death of Col. John J. Hardin- Of the 1st regiment Illinois volunteers LCCN91793588
battle of buena vistagraphic art
Benjamin-Disraeli-Earl-of-Beaconsfield (cropped)
1st earl of beaconsfieldalbumen prints
Portrait of a Man (1st quarter of the 19th cenutry)
19th-century pastel portraits of men at half lengthunknown painters
Portrait of John, Duke of Malborough (4671385)
national library of wales portrait archivejohn churchill
Portrait of John, Duke of Malborough (4671384)
national library of wales portrait archivejohn churchill
Valcavado Beatus f. 153v - First and second bowls
1st bowl - on the earth2nd bowl - on the sea
Funeral 1st Mass Arty Harrisons landing LCCN2004660814
drawings (documentary) collection in the library of congressdrawings by alfred waud
History of the birds of NZ 1st ed p000-2
a history of the birds of new zealand by bullerfalco novaeseelandiae (illustrations)
History of the birds of NZ 1st ed p026-2
a history of the birds of new zealand by bullerstrigops habroptila (illustrations)
History of the birds of NZ 1st ed p160
phasianidae illustrationscoturnix novaezelandiae
History of the birds of NZ 1st ed p062-2
a history of the birds of new zealand by bullerheteralocha acutirostris (illustrations)
GUGG Windows Open Simultaneously 1st Part, 3rd Motif
paintings in the solomon r. guggenheim museumrobert delaunay
Lady Meysey-Thompson
female portrait paintings by john singer sargenthenry meysey-thompson
Ne zhdali (1st version)
1880s interiors in artsurprise in art
János Thorma The 1st of October
paintings by jános thorma in the hungarian national gallery1903 paintings in hungary
Lord Strathcona (HS85-10-19863)
1st baron strathcona and mount royaldonald smith
Lord Strathcona (HS85-10-19861)
1st baron strathcona and mount royaldonald smith
Prince Adolphus, Duke of Teck
british nobility by laszlomale portraits by laszlo
Portrait of Sir Hugh Middleton (4671693)
national library of wales portrait archive1st baronet
Supt Reception 1st&2nd Batt-077 (34041287844)
celebritiespeople
KDA 2300 (35113357283)
grassarmy
2101 - 2200 of 19,364 Next page
/ 194