11,506 Free Images of 68

cc-zeroaboard uss nimitz (cvn-68)photographs by leonhard lenzvehiclemilitarynavyaircraftpages with mapsjetaviation
Valkenburg-Neerhem 68 (1)
pages with mapsvillage
Felsenburg Rißweg 68 Loschwitz 2
architecturevillage
Lightning at thunderstorm from Spandauer-See-Brücke 68
nightdark
151008-N-OX430-106 (21940131288)
lightsea
RC Lens - AS Nancy-Lorraine (19-01-2019) 68
self-published worksport
RC Lens - US Orléans (17-05-2019) 68
self-published workcc-zero
Cumulative distribution function for normal distribution, mean 0 and sd 1
self-published workerror function
Tagung der Vereinigung Initiative Pelzgestaltung VIP in Berlin, 1985 (68)
photographs taken by jürgen bahlscc-zero
US Navy 091027-N-4154B-077 Machinery Technician 1st Class William Porter climbs out of a hold aboard a fishing vessel
aboard uss anzio (cg-68)
US Navy 111209-N-QL471-634 U.S. Navy ships cruse together during a sea power demonstration
seasidesea
US Navy 030309-N-2385R-001 An FA-18A Hornet launches from the flight deck
militaryvehicle
Aviron 2015 - World Championships - 68
waterboat
Bernadottestraße 68 Berlin-Dahlem
bernadottestraße (berlin-dahlem)self-published work
Créteil - Dunkerque - LNH - 30 mars 2017 - 68
self-published worksport
BlackLivesMatter protest Berlin 2020-05-30 68
celebritiesgroup
F-35C Lightning II 141104-N-DC018-275
general views of uss nimitz (cvn-68)vehicle
Ivoi - La Mort de l’Aigle (page 68 crop)
book illustrationblack and white
US Navy 110722-N-TY225-318 A visit, board, search and seizure team investigates a suspected pirate skiff
piracy in somaliaboat
US Navy 110811-N-YM590-011 Sailors man the helm console during a general quarters drill
anti-flash gearpeople
US Navy 040821-N-8158F-004 Crew members participate in a mass casualty drill aboard the flight deck of the nuclear
aboard uss nimitz (cvn-68)group
US Navy 031015-N-2385R-005 Seaman Juan Alicianieves from Bonce, Puerto Rico, stands the lee helmsman watch
aboard uss nimitz (cvn-68)
US Navy 091112-N-3038W-352 Aviation Ordnancemen upload a laser-guided bomb to an F-A-18C Hornet
aboard uss nimitz (cvn-68)aviation ordnanceman
USS Nimitz transits the Arabian Gulf. (37182873081)
vehicleboat
Immagini nel libro La Moda, pp. 68–69
découvertes gallimardnon-fiction books
RC Lens - AS Béziers (04-01-2019) 68
grassfield
Horn - Grenzstein 68 (4)
self-published workrock
One scene at 2012 Pokka 1000km (68)
self-published work2012 pokka 1000km
Mietenwahnsinn demonstration Berlin 2021-05-23 68
self-published workpavement
FridaysForFuture protest Berlin 13-12-2019 demonstration 68
self-published workcc-zero
Berlin gegen 13 demonstration 68
self-published workpages with maps
Article13 demonstration Berlin 68
self-published workgroup
Front of the Seebrücke demonstration Berlin 06-07-2019 68
self-published workcc-zero
Geul-overstroming juli 2021 (68)
self-published worktown
Ende Gelände Orange finger 2020-09-26 68
self-published workcelebrities
Ende Gelände AKK finger 2020-09-26 68
self-published workarmy
Sossenheim, Alt-Sossenheim 68
architecturevillage
Child with pear and hamper - porcelain made in England at the Bow factory in East London, about 1765-68 - Museum of Villa Pignatelli in Naples (45076450661)
villa pignatelli (naples) - interiors
Rauschenberg Fulda 2019-07-14 68
landscapetree
Brussels-Public domain event, 26 May 2018 (68)
self-published workinterior
Carpi (Modena) - 25 aprile 2017 68
self-published worksidewalk
CUBA. LGTB AU CENESEX (68)
self-published workgroup
Fürstenstraße 68 Chemnitz
architecturetown
US Navy 030502-N-2385R-003 An F-A-18F Super Hornet prepares to take off from one of four steam-powered catapults during night flight operations on the flight deck aboard USS Nimitz (CVN 68)
aircraftvehicle
US Navy 030625-N-9319H-016 A plane director prepares to assist an F-A-18 Hornet to one of four steam driven catapults during flight operations on the flight deck aboard USS Nimitz (CVN 68)
militaryaircraft
US Navy 030518-N-2385R-002 An F-A-18F Super Hornet prepares to launch from one of four steam-powered catapults on the flight deck aboard USS Nimitz (CVN 68)
militaryvehicle
US Navy 031002-N-9319H-003 Aviation Ordnanceman assigned to the Black Aces of Strike Fighter Squadron Four One (VFA-41) prepare to arm an F-A-18F Super Hornet with an AIM-9 Sidewinder missile on the flight deck of USS Nimitz (CVN 68)
aircraftvehicle
US Navy 070619-N-0890S-036 An E-2C Hawkeye, assigned to the Wallbangers of Carrier Airborne Early Warning Squadron (VAW) 117, launches off the flight deck of nuclear-powered aircraft carrier USS Nimitz (CVN 68)
militarynavy
US Navy 060831-N-8158F-377 An F-A-18E Super Hornet assigned to the Fighting Redcocks of Strike Fighter Squadron Two Two (VFA-22) launches from the flight deck aboard the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
vehiclejet
Naval Air Station North Island, Calif. (Nov. 5, 2003) -- USS Nimitz (CVN 68), homeported at Naval Air Station North Island, Coronado, Calif., returns home to San Diego. Nimitz flew more than 6,500 mi
animalsbird
180609-N-NO901-006 (42037590724)
militaryvehicle
120421 Vacinação dos profissionais da Educação e pessoas com mais de 68 anos contra o Coronavírus Foto Carlos Bassan (51111889161)
covid-19 vaccination in campinas
Lens - Marseille (03-02-2021) 68
self-published workcc-zero
Budleigh Salterton (2020-08-16) 68
seashorewater
US Navy 030912-N-2143T-005 crewmembers of USS Nimitz (CVN 68) enjoy a view of fish
underwater worldlight
US Navy 070718-N-9760Z-002 An MH-60S Seahawk, assigned to the
aboard uss nimitz (cvn-68)navy
Entraînement RC Lens - 2 mai 2018 68 (cropped)
self-published worksport
Parforceheide 2021-02-24 68
self-published workpages with maps
RebelRiders Berlin 2020-09-07 68
peoplecity
FridaysForFuture demonstration Berlin 15-03-2019 68
self-published workgroup
Front of the 3rd Global Climate Strike Berlin FridaysForFuture demonstration 68
3rd global climate strike berlin fridaysforfuture demonstrationself-published work
US Navy 110515-N-YM590-086 Ensign Austin E. Ayres plots the ship's position on a maneuvering board on the bridge of the guided-missile cruiser USS
uss anzio (cg-68)
Plate 68- Hercules and Cerberus (Cerberum domat Hercules), from Ovid's 'Metamorphoses' MET DP866515
artworks with known accession numberartworks without wikidata item
Augustins - Serpents, crapauds et papillons - Otto Marseus van Schrieck Inv.2004 1 68 49x61
still-life paintings with animals17th-century still-life paintings
US Navy 091022-N-3038W-939 Aviation Ordnanceman aboard the aircraft carrier USS Nimitz (CVN 68) attach a cargo pendant to a MH-60S Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
militaryvehicle
US Navy 091104-N-3038W-403 The guided-missile destroyer USS Sampson (DDG 102) trails the Military Sealift Command fast combat support ship USNS Bridge (T-AOE 10) and the aircraft carrier USS Nimitz (CVN 68)
boatsea
US Navy 090927-N-3038W-090 An F-A-18C Hornet assigned to the Tophatters of Strike Fighter Squadron (VFA) 14 launches from the flight from the flight deck of the aircraft carrier USS Nimitz (CVN 68)
militaryaircraft
US Navy 030604-N-2385R-001 Personnel assigned to Sea Control Squadron Twenty Nine (VS-29) begin start-up checks on an S-3B Viking on the flight deck aboard USS Nimitz (CVN 68)
militaryaircraft
US Navy 070524-N-4420S-069 Aviation Boatswain's Mate 3rd Class Jerry Bickings taxies an E-2C Hawkeye, aboard USS Nimitz (CVN 68)
militaryvehicle
US Navy 070804-N-9760Z-021 The nuclear-powered aircraft carrier USS Nimitz (CVN 68), Military Sealift Command fast combat support ship USNS Rainier (T-AOE 7), and guided-missile destroyer USS Chafee (DDG 90) conduct a replenish
shipnavy
US Navy 070903-N-9760Z-094 Sailors aboard nuclear-powered aircraft carrier USS Nimitz (CVN 68) participate in a replenishment at sea with Military Sealift Command fast-combat support ship USNS Rainier (T-AOE 7)
personnel at underway replenishmentwater
George Housman Thomas (1824-68) - The Naval Review at Spithead, 23 April 1856 - RCIN 405118 - Royal Collection
18551852
US Navy 100712-N-2918M-115 A C-2A Greyhound assigned to the Providers of Fleet Logistics Support Squadron (VRC) 30 lands aboard the aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 100712-N-2918M-104 An E-2C Hawkeye assigned to the Wallbangers of Carrier Airborne Early Warning Squadron (VAW) 117 lands aboard the aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 070809-N-9760Z-044 An F-A-18C, assigned to the Sunliners of Strike Fighter Squadron (VFA) 81, prepares to land on the flight deck of the nuclear-powered aircraft carrier USS Nimitz (CVN 68)
strike fighter squadron 81 (united states navy)f/a-18c hornet in flight
US Navy 070930-N-7128A-050 Sailors man the rails of nuclear-powered aircraft carrier USS Nimitz (CVN 68) as she enters San Diego Bay
skylinecity
US Navy 070915-N-5148B-047 A C-2A Greyhound, assigned to the Providers of Carrier Logistic Support Squadron (VRC) 30, lands on the flight deck aboard nuclear-powered aircraft carrier USS Nimitz (CVN 68)
militaryvehicle
US Navy 100105-N-3038W-020 An EA-6B Prowler assigned to the Black Ravens of Tactical Electronic Attack Squadron (VAQ) 135 prepares to launch from the aircraft carrier USS Nimitz (CVN 68)
vehiclesea
US Navy 030625-N-2385R-001 A flight deck handler directs an S-3B Viking onto one of the four steam powered catapults on the flight deck aboard USS Nimitz (CVN 68)
militaryvehicle
US Navy 030417-N-8273J-004 Rear Adm. Samuel Jones Locklear, Commander Cruiser Destroyer Group Five (CCDG-5), reads from the Passover Hagaddah (prayer book) during a Passover Seder dinner in the wardroom aboard USS Nimitz (CVN 6
aboard uss nimitz (cvn-68)samuel j. locklear
US Navy 090924-N-0789J-163 The visit, board, search and seizure (VBSS) team, assigned to the guided-missile cruiser USS Anzio (CG 68) and U.S. Coast Guard Maritime Safety and Security Team 91104 conduct a simulated boarding exe
vehiclewater
Frankfurt, Günthersburgallee 68
self-published workarchitecture
Moscow, Gilyarovskogo 68 (Naprudny) Aug 2009 01 (DXO)
self-published workarchitecture
Rijksmuseum Boerhaave in 2019 foto 68
self-published workpages with maps
FridaysForFuture protest Berlin 08-11-2019 68
street scenepeople
Airpower over USS Nimitz DVIDS256110
militaryvehicle
HSC-8 Missile Exercise 150204-N-NI474-237
militarynavy
160823-N-DA275-175 160823-N-DA275-175
aircraftaviation
US Navy 090218-N-3946H-033 Sailors secure an EA-6B Prowler engine in its cradle
grumman ea-6 prowler maintenanceaboard uss nimitz (cvn-68)
US Navy 111016-N-ZZ999-027 Electronics Technician 3rd Class Robert Taylor performs maintenance on a radar terminal aboard the guided-missile cruise
uss anzio (cg-68)
US Navy 110721-N-TY225-034 USS Anzio, USNS Alan Shepard perform a replenishment at sea
usns alan shepard (t-ake-3)uss anzio (cg-68)
US Navy 030224-N-6141B-092 Damage Control Central (DCC) aboard USS Anzio
interior communications electricianaboard uss anzio (cg-68)
US Navy 020926-N-0000X-001 The USS Nimitz (CVN 68) steams alongside the Princeton as the American Flag waves proudly in the wind
aboard uss princeton (cg-59)red
US Navy 100129-N-3327M-115 A sailor secures an aircraft aboard USS Nimitz
strike fighter squadron 86 (united states navy)aboard uss nimitz (cvn-68)
FridaysForFuture protest Berlin 2020-07-02 bicycle demonstration 68
self-published workcelebrities
Dyke March Berlin 2020-07-25 68
peoplecity
Danni bleibt demonstration Dannenrod 2020-10-04 68
self-published workcelebrities
BlackLivesMatter protest Karl-Marx-Allee Berlin 2020-06-06 68
self-published workcc-zero
US Navy 070817-N-0890S-021 An MH-60S Seahawk, assigned to the
aboard uss nimitz (cvn-68)fly
US Navy 051025-N-0361G-007 Airman Justin Gevedon of Redding, Calif., carries jet intake protective covers across the flight deck
aboard uss nimitz (cvn-68)
US Navy 030322-N-2143T-001 An Aviation Boatswain's Mate removes a forward-looking infrared (FLIR) pod
aboard uss nimitz (cvn-68)aircraft flir systems
2401 - 2500 of 11,506 Next page
/ 116