110,450 Free Images of C

cc-zeroaboard uss john c. stennis (cvn-74)vehicleaircraftmilitarycc-pd-marknavyfiles uploaded by daderotaviationauthor died more than 100 years ago public domain images
A propeller and a R-2800-51 engine (20810095500)
self-published workcc-zero
NC Lathe 5T28 ATC M-C (21032515024)
self-published workcc-zero
VRC-30 Providers 150310-N-TQ272-399
naval air station north island in the 2010sgrumman c-2 greyhound
C //.'(..,* /t-ffb(Ki (u?///ff i.
animalsmammals
Verhaeren - James Ensor intext C
james ensor
Fakse Kalkbrud C Soya-Jensen
faxe kalkbrud
Studio of Boucher - Venus, c. 1760
françois boucher
Franz Delitzsch, c. 1865-1880
franz delitzsch
Joseph C. Cabell LCCN2003688684
joseph carrington cabell
Professor A. A. Keen, c. 1860
faculty of tufts university
Andrew Johnson, c. 1865-1875
andrew johnson
11090301 Decorated Initial C
getty center manuscripts
Franz Sigel, c. 1861-1865
franz sigel
Icon of the Virgin Mary of the Don XVI c
for ladies
Capmartin N 23 (c)
postcards published by capmartin
Capmartin N 03 (c)
postcards published by capmartin
Capmartin N 09 (c)
postcards published by capmartin
Chodowiecki Basedow Tafel 56 c
elementarwerkwire
C Paludan Müller
caspar paludan-müllercombover
Defense.gov News Photo 120113-N-BT887-277 - Sailors perform maintenance on an F A-18E Super Hornet from Strike Fighter Squadron 14 aboard the aircraft carrier USS John C. Stennis CVN 74 in
f/a-18e super hornet on flight decksoperation enduring freedom
Jacob Willemsz. de Wet (c.1610-c.1671) - The Hosts of Pharoah Engulfed by the Red Sea - 1139801 - National Trust
old testament paintings in national trust placesjacob de wet (i)
Hieronymus Custodis (active c.1585-1598) (attributed to) - Sir Francis Walsingham (c.1530–1590), MP, Chancellor of the Order of the Garter (1578–1588) or Sir J - 1257219 - National Trust
male portrait paintings in national trust places
John Bettes (c.1531-before 1576) (possibly) - William Ffytch (c.1496–1578), with his Hand on a Skull, aged 51 (previously called, impossibly, Thom - 517698 - National Trust
male portrait paintings in national trust places
Vincenzo Foppa (c.1427-c.1515) (style of) - Saint Louis of Anjou (1274–1297), Bishop of Toulouse - 509840 - National Trust
paintings of christian saints holding croziersreligious paintings in national trust places
View of a church and convent in the rocks at Inkerman. Edmund Spencer. Travels in Circassia, Krim-Tartary &c. 1838. Letter VIII. P.78
krim-tartary &c (1838)travels in circassia
John James Baker (c.1648-c.1712) - Sir Henry Parker of Honington (1639–1713), 2nd Bt, MP - 1257153 - National Trust
male portrait paintings in national trust places2nd baronet
HUA-31496-Interieur van het Haagsche Koffiehuis Vredenburg C 730 te Utrecht de café biljardzaalNB Het adres Vredenburg C 730 is in 1890 gewijzigd in Vredenburg
collection drawings and prints from het utrechts archief
Carbarlick Acid 1904
skull and crossbone iconspoisons in art
Princes Vasily and Constantin of Yaroslavl (17-18 c., Yaroslavl museum)
icons in yaroslavl museum-preserve17th-century icons of russia
Reinier Nooms (Zeeman) (c.1623-1664) - Action between Spanish and Swedish Ships, c.1650 - BHC0740 - Royal Museums Greenwich
naval battles involving spainreinier nooms
C-27 Crew Conducts First Air Drop (4754100577)
people of the united states air forceafghan air force in 2010
Defense.gov News Photo 101109-N-0696M-232 - Chairman of the Joint Chiefs of Staff Adm. Mike Mullen U.S. Navy is welcomed to the Kingdom of Tonga by Ambassador C. Steven McGann and Brig
militaryarmy
Lamp, Egypt, c. 1360 AD, glass painted with enamel and gold - Freer Gallery of Art - DSC04603
self-published workcc-pd-mark
Major John Mason by James C. G. Hamilton, dedicated 1889 - Palisado Green - Windsor, Connecticut - DSC04407
self-published workcc-pd-mark
Major John Mason by James C. G. Hamilton, dedicated 1889 - Palisado Green - Windsor, Connecticut - DSC04404
self-published workcc-pd-mark
Cyperus involucratus specimen in the J. C. Raulston Arboretum (North Carolina State University), 4415 Beryl Road, Raleigh, North Carolina, USA.
plantsleaf
Cephalotaxus fortunei specimen in the J. C. Raulston Arboretum (North Carolina State University), 4415 Beryl Road, Raleigh, North Carolina, USA.
springgarden
Capsicum annuum specimen in the J. C. Raulston Arboretum (North Carolina State University), 4415 Beryl Road, Raleigh, North Carolina, USA.
naturebird
ROCAF C-130H 1302 Taxiing at Songshan Air Force Base 20140821
aircraftvehicle
ROCAF C-130H 1311 Taxiing at Songshan Air Force Base Apron 20161124a
aircraftvehicle
New Mexico State Collection of Arthropods Catalog #: NMSUACP0058635 Secondary Catalog #: 25102 Taxon: Euxoa albipennis (Grote) Family: Noctuidae Determiner: C. Harp (2005) Collector: C. Harp Date: 200
butterflyarthropod
US Navy 030214-N-6895M-504 C-2 Greyhound launches from CV 71
militaryvehicle
US Navy 020713-N-6492H-517 C-2A landing
militaryvehicle
US Navy 070606-N-6081J-041 Secretary of the Navy (SECNAV) the Honorable Donald C. Winter speaks with Capt. Bruce Boynton (second from right), commanding officer of the Medical Treatment Facility aboard the Military Sealift Comm
naval station norfolknavy
US Navy 070629-N-3729H-225 An F-A-18C Hornet, assigned to the Blue Diamonds of Strike Fighter Squadron (VFA) 147, launches off the flight deck of Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
militaryvehicle
US Navy 060829-N-3642E-004 Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter observes the guided-missile cruiser USS Shiloh (CG 67) during her sea and anchor detail from the ship's port bridge-wing
donald c. winter in 2006bridge wing
US Navy 051021-N-0361G-009 Aviation Boatswain's Mate 3rd Class Jessica Doche directs a C-2A Greyhound
militaryaircraft
US Navy 060114-N-2568S-110 During a ceremony held aboard Naval Station Ingleside, Texas, Secretary of the Navy Dr. Donald C. Winter officially places the amphibious transport dock ship USS San Antonio (LPD 17) in commission
commissioning of uss san antonio (lpd-17)donald c. winter in 2006
US Navy 060128-N-2568S-166 U.S. Army Lt. Col. Shawn McGinley demonstrates ways they examine potential improvised explosive devices to the Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter
militaryarmy
US Navy 060602-N-3642E-009 Secretary of the Navy (SECNAV) the Honorable Dr. Donald C. Winter receives a tour from Capt. Dennis Fitzpatrick Commanding Officer of USS John F. Kennedy (CV 67)
aboard uss john f. kennedy (cv-67)people at naval station mayport
US Navy 070408-N-9928E-046 Cmdr. William Kennedy, the ship's chaplain, presides over the Easter Sunrise Service on the flight deck of Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)easter sunrise services
US Navy 070302-N-2659P-127 Hospital Corpsman 1st Class Benjamin Morgan stitches a laceration on the hand of Aviation Boatswain's Mate Airman Apprentice Janssen Eilenberger in the medical ward aboard USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)aviation boatswain's mate
US Navy 070310-N-2659P-324 Aviation Structural Mechanic 3rd Class Robert Potts hooks up and tests an S-3B Viking, assigned to the Topcats of Sea Control Squadron (VS) 31, aboard Nimitz-class aircraft carrier USS John C. Stennis
aboard uss john c. stennis (cvn-74)
US Navy 070323-N-3642E-288 Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter announces the next Arleigh Burke-class guided missile destroyer will bear the name of Cpl. Jason L. Dunham
donald c. winter in 2007jason dunham
Vice Adm. Arthur C. Davis, USN (cropped)
black and whitemonochrome
US Navy 090626-N-7780S-048 Sailors and Marines push an F-A-18C Hornet from assigned to the Death Rattlers of Marine Strike Fighter Squadron (VMFA) 323 into place after flight operations aboard the aircraft carrier USS John C. S
aircraftvehicle
US Navy 111130-N-BT887-199 A jet lands aboard USS John C. Stennis
militaryvehicle
US Navy 111123-N-BT887-156 An F-A-18F Super Hornet from the Black Aces of Strike Fighter Squadron (VFA) 41 launches off the Nimitz-class aircraft c
aircraftvehicle
US Navy 091208-N-9928E-144 Aviation Structural Mechanic 3rd Class Tyler Clausen signals an MH-60S Sea Hawk helicopter aboard USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)vehicle
US Navy 100123-N-2475A-214 The honor guard fires a rifle volley during a burial at sea ceremony aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
three-volley salutetraffic
US Navy 100511-N-9712C-003 Sailors unload oil containment equipment from an Air Force C-17 transport aircraft at Naval Air Station Joint Reserve Base New Orleans
vehiclecar
US Navy 100825-N-7032B-273 Rear Adm. C. Forrest Faison III, commander, Naval Medical Center San Diego, reads to children in the pediatrics clinic during a visit by U.S. Rep. Susan Davis to promote children's literacy
naval medical center san diegoc. forrest faison iii
US Navy 090416-N-6597H-091 Fire Controlman 2nd Class Geneva Myers, from Kinston, N.C., conducts scheduled maintenance on a Phalanx Close In Weapons System aboard the aircraft carrier USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)fire controlman
US Navy 090423-N-9928E-010 Sailors aboard the USS John C. Stennis (CVN 74) observe a replenishment at sea between the Military Sealift Command fleet replenishment oiler USNS Tippecanoe (T-AO 199) and the aircraft carrier USS Jo
shipnavy
US Navy 081206-N-8273J-458 hief of Naval Operations (CNO) Adm. Gary Roughead, center, and Secretary of the Navy (SECNAV) the Honorable Donald C. Winter, far right, congratulate the U.S. Naval Academy Midshipmen on their 34-0 vi
gary roughead in 20082008 army-navy game
US Navy 110214-N-ZC343-001 USS Princeton (CG 59) departs Naval Base San Diego
vehicleboat
US Navy 090109-N-1522S-004 Rear Adm. Townsend G. Alexander relieves Rear Adm. Michael C. Vitale as Commander, Navy Region Southeast
change of command ceremonies of the united states navymale military people saluting
US Navy 090123-N-6538W-001 Aviation Boatswain's Mate (Handling) Airman Recruit Courteney Smith, from Oxford, Ohio, dries pad eyes in the hangar bay of aircraft carrier USS John C. Stennis (CVN 74)
aviation boatswain's matehandler
US Navy 090526-N-9928E-367 The aircraft carrier USS John C. Stennis (CVN 74) transits the Pacific Ocean to Pearl Harbor, Hawaii as part of a scheduled port visit during a six-month deployment to the western Pacific Ocean
vehicleship
US Navy 090212-N-8157C-010 he Japan Maritime Self-Defense Force destroyers JS Oonami (DD 111), right, and JS Amagiri (DD 154), are underway with the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
vehiclenavy
US Navy 090216-N-6538W-210 Aviation Boatswain's Mate (Equipment) Airman Halston Mather, from St. Louis, tightens bolts on catapult deck plates aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
aviation boatswain's mateequipment
US Navy 091103-N-5253W-066 Sailors from Fleet Activities Yokosuka, dressed as Commodore Matthew C. Perry and members of his crew, march through Tokyo during the Jidai Matsuri parade
united states navy images from tokyopeople
US Navy 080620-N-2610F-001 Aviation Boatswain's Mate Airman Patrick Dent observes flight operations while standing in a crash and salvage hot-suit-man watch on the flight deck aboard the Nimitz-class aircraft carrier USS John C
aboard uss john c. stennis (cvn-74)aviation boatswain's mate
US Navy 070807-N-3642E-403 Secretary of the Navy (SECNAV) the Honorable Dr. Donald C. Winter, gives his official SECNAV coin to Chuck Hilderth during the Defense Advanced Research Projects Agency (DARPA) Tech conference
donald c. winter in 2007amputee
US Navy 070817-N-2659P-330 Aircraft from Carrier Air Wing (CVW) 9 fly over Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) during a practice flight demonstration for an upcoming Tiger Cruise
boatsea
US Navy 070822-N-3642E-891 Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter thanks local children after watching a musical performance during his tour of Sassamungga
celebritiespeople
US Navy 070820-N-0684R-384 Sailors and Marines stand at attention while manning the rails as Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) passes the USS Arizona Memorial
boatship
US Navy 070703-N-3729H-258 Aircraft handler Lt. Cmdr. Doug Thornton sits in flight deck control overseeing all flight deck activities during nighttime flight operations on board Nimitz-class aircraft carrier USS John C. Stennis
aboard uss john c. stennis (cvn-74)light
US Navy 070706-N-2888Q-001 Maj. Matt McGath briefs several Michigan recruiters before their flight on Fat Albert, the U.S. Marine Corps C-130 Hercules assigned to the Blue Angels
lockheed c-130 hercules interiorsfat albert (aircraft)
US Navy 070427-N-3642E-137 Secretary of the Navy (SECNAV), the Honorable Dr. Donald C. Winter interviews with Lila Lazarus, Fox News Detroit, during Navy League ceremony at the Detroit Athletic Club
lowlightlight
US Navy 080609-N-6538W-181 Aviation Ordnanceman Airman Stephen Goode tightens the MK-122 safety switch on a guided bomb unit (GBU) 38 aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)aviation ordnanceman
US Navy 070122-N-0684R-124 Plane captains from each squadron stand by while pilots conduct their pre-flight inspections prior to flight operations aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
vehiclenavy
US Navy 070120-N-2659P-006 Aviation Electronics Technician 2nd Class Thomas Hayward poses for his cruise book portrait on the aft mess decks aboard the Nimitz-Class aircraft carrier USS John C. Stennis (CVN 74)
mess decks of uss john c. stennis (cvn-74)aviation electronics technician
US Navy 070122-N-0684R-154 An F-A-18C Hornet assigned to the Argonauts of Strike Fighter Squadron One Four Seven (VFA-147) launches from the flight deck of USS John C. Stennis (CVN 74)
strike fighter squadron 147 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 070210-N-0684R-052 Boatswain's Mate 3rd Class Richard Adrian looks through binoculars for surface contacts while standing the port forward watch on the signal bridge as Nimitz-class aircraft carrier USS John C. Stennis
people with binocularsbig eyes
US Navy 110809-N-BT887-276 Aviation Boatswain's Mate 3rd Class Terrance Wever directs an E-2C Hawkeye aboard USS John C. Stennis (CVN 74)
carrier airborne early warning squadron 112 (united states navy)aboard uss john c. stennis (cvn-74)
Jaguar C TYPE dutch licence registration unknown pic2
vehiclecar
Manuscript in Toba-Batak language, central Sumatra, early 1800s - Robert C. Williams Paper Museum - DSC00360
self-published workcc-pd-mark
Flowers, China, on Tetrapanax papyrifer paper - Robert C. Williams Paper Museum - DSC00394
self-published workcc-pd-mark
Warwick Hours, perhaps London c. 1430-1445, and Ferrara Italy c. 1482, - Morgan Library & Museum - New York City - DSC06575
self-published workcc-pd-mark
Otomi spirit figure, southern Mexico, bark paper, undated - Robert C. Williams Paper Museum - DSC00373
self-published workcc-pd-mark
Otomi tools for making bark paper, Otomi people, southern Mexico - Robert C. Williams Paper Museum - DSC00667
self-published workcc-pd-mark
They Took Their Wives with Them on Their Cruises, by N.C. Wyeth, c. 1938, oil on board - Peabody Essex Museum - DSC07043
self-published workcc-pd-mark
R32 C train at 14th Street NYC Subway September 2015
vehiclecar
C-17 Globemaster Takeoff Tinker AFB 07
militaryvehicle
C-17 Globemaster Takeoff Tinker AFB 05
militaryvehicle
C-17 Globemaster Takeoff Tinker AFB 06
militaryvehicle
C-17 Globemaster Takeoff Tinker AFB 03
militaryvehicle
Book from the Temple of the Living God, 1662-1723 - Robert C. Williams Paper Museum - DSC00412
self-published workcc-pd-mark
Christ crowned with thorns, Upper Bavaria, c. 1500, limewood, polychrome - Germanisches Nationalmuseum - Nuremberg, Germany - DSC03000
self-published workcc-pd-mark
5201 - 5300 of 110,450 Next page
/ 1105