51,426 Free Images of One

with insigniagreenwatersummernatureplantsmilitaryaircraftlightvehicle
Russia Victory Commemorative Flag (alternative)
red and white flagrussian
Flag of RENAMO
yellow flagleft
Bandera de Navarra
self-published workyellow flag
Flag of Salzburg (state)
files with no machine-readable sourceself-published work
Flag of Maupiti
svg flags with an aspect ratio of 3:2one white
Naval Jack of Morocco
yellow flagnaval
Flag of Stellaland (early 1883)
self-published workwith insignia
2-(3-(4-(3-chlorophenyl)piperazin-1-yl)propyl)-(1,2,4)triazolo(4,3-a)pyridin-3(2H)-one 200
svg chemistry symbols:path textself-published work
Windmill wind big
springtree
Background beautiful biology
backgroundscenes
Child kid little
backgroundchristmas
The beauty green clouds
backgroundlandscape
Fruit glass heart dessert
symbolfood
Portrait adult male
charactermale
In flight beach sand
travelbird
A little plant slow
vegetablesanimals
Backed up sure matrix
technologyclock
Nature mammalia spring
landscapeanimals
Food background dry
backgroundfish
One scene at 2014 pokka sapporo 1000km
vehiclecar
US Navy 061129-N-8591H-268 Landing signal officers watch as an F-A-18C Hornet assigned to the Golden Dragons of Strike Fighter Squadron One Nine Two (VFA-192) lands on the flight deck of USS Kitty Hawk (CV 63)
militaryvehicle
US Navy 060207-N-1573O-049 An F-A-18C Hornet assigned to the Salty Dogs of Air Test and Evaluation Squadron Two Three (VX-23) launches from one of four steam-powered catapults
aircraftvehicle
US Navy 040229-N-4374S-006 Aviation Warfare Systems Operator 2nd Class Wes Vinson, assigned to the Red Lions of Helicopter Anti-Submarine Squadron One Five (HS-15), monitors his surroundings for any visual contacts aboard an HH
militaryarmy
US Navy 070130-N-4649C-076 Boatswain's Mate 2nd Class Albert Sebastian clears an SH-60 helicopter assigned to Helicopter Anti-Submarine Squadron Light Five One (HSL-51), as it takes off from Arleigh Burke-class guided missile d
sagami bayvehicle
US Navy 090217-N-2456S-035 Aviation Boatswain's Mate (Fuel) 3rd Class Jeff Miller, from Kingston, Okla., left, stands number one nozzleman while attempting to put out a class bravo fire
fire hosefuel
US Navy 050121-N-6363M-004 An F-14B Tomcat assigned to the Swordsmen of Fighter Squadron Three Two (VF-32) launches off one of the four steam-powered catapults aboard USS Harry S. Truman (CVN 75)
militaryvehicle
US Navy 050121-N-4308O-095 An F-14 Tomcat assigned to the Swordsmen of Fighter Squadron Three Two (VF-32 launches off one of four steam-powered catapult aboard the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)military
US Navy 050217-N-3488C-067 An F-A-18F Super Hornet, assigned to the Diamondbacks of Strike Fighter Squadron One Zero Two (VFA-102), equipped with a Shared Reconnaissance Pod (SHARP), prepares to land
militaryaircraft
US Navy 050421-D-5613J-089 Explosive Ordnance Disposal Mobile Unit Six (EODMU-6) team members climb back one of the EOD support vessels being used in the search of a crashed U.S. Air Force F-16 Falcon
vehiclewater
US Navy 030701-N-9319H-011 Chief Aviation Boatswain's Mate Michael Lauricella directs an F-A-18 Hornet into position for launch from one of the four steam powered catapults on the flight deck aboard USS Nimitz (CVN 68)
militaryaircraft
US Navy 030317-N-5319A-005 Dive Platoon member Builder 1st Class Dean Ferguson assigned to Commander Task Unit 55.4.3 (CTU-55.4.3) sets up his dive gear
united states navy explosive ordnance disposalbuilder (united states navy)
US Navy 021114-N-1810F-018 An F-14 Tomcat assigned to the Black Knights of Fighter Squadron One Five Four (VF-154) launches past steaming catapults on the bow of the ship
militaryvehicle
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations inAngat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
waterriver
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summerwater
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summerwater
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summerwater
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summerwater
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summerwater
US Navy 070216-N-3729H-083 An F-A-18C Hornet from the Blue Diamonds of Strike Fighter Squadron One Four Six (VFA-146) flies over the flight deck of the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
militaryaircraft
Gravemarker Moon, Yoshitoshi, 3rd month of 1886 CE
1886 paintingsukiyo-e
Backgrounds bill business
backgroundsymbol
Background beautiful biology
backgroundscenes
Jewellery bodypaint face
waterbody
Woman young black
fantasygirl
US Navy 040728-N-3488C-003 An F-A-18F Super Hornet assigned to the Diamondbacks from Strike Fighter Squadron One Zero Two (VFA-102) prepares to launch off the flight deck of USS Kitty Hawk (CV 63)
militaryvehicle
US Navy 040309-N-4374S-017 Sailors assigned to Explosive Ordnance Disposal Group Two (EODMU 2), Det. Four, reattach a rope to an HH-60H Seahawk assigned to the Red Lions of Helicopter Anti-Submarine Squadron One Five (HS-15) du
militaryaircraft
US Navy 040108-N-3236B-001 Equipment Operator 2nd Class John Flemming from Philadelphia, Pa., assigned to Explosive Ordnance Mobile Unit Three (EODMU-3) Detachment One, Stationed in San Diego Calif., provides training to Kenyan
counter-ied trainingnavy of kenya
US Navy 051111-F-5480T-007 An F-14D Tomcat, assigned to the Blacklions of assigned to the Blacklions of Fighter Squadron Two One Three (VF-213), conducts a mission over the Persian Gulf-region
aircraftvehicle
US Navy 030317-N-5319A-008 Staff Sgt. Steven Torrance, consults with Staff Sgt. Kevin Harris assigned to Commander Task Unit 55.4.3 (CTU-55.4.3) while setting his compasses for the new degree difference
united states navy explosive ordnance disposalnautical compasses
US Navy 070108-N-8907D-006 A plane director moves an E-2C Hawkeye assigned to the Tigertails of Carrier Airborne Early Warning Squadron One Two Five (VAW-125) into launch position aboard the Nimitz-class aircraft carrier USS Dw
aviationvehicle
US Navy 071113-N-3857R-007 Builder 1st Class William Waldron guides Equipment Operator 3rd Class Earnest Wilson into place as he operates a bulldozer to clear debris so concrete can be placed to patch one of the runways at Camp
builder (united states navy)military loaders
One of two bald eagles were found dead in a field about 50 yards apart near Martinez Rd. in Thibodaux, LA. Poisoning is suspected. A GPS unit was placed near it as a size reference. Public Domain Pho
animalsbird
US Navy 100128-N-5345W-277 The Presidential Palace sits in ruins while hundreds of displaced Haitians take shelter in one of the many tent cities just outside the palace's main gate
aboard uss bataan (lhd-5)architecture
US Navy 030824-N-1577S-003 Aircrew Survival Equipmentman 1st Class Matt Broderson, from Cedar Rapids, Iowa, a member of Explosive Ordnance Disposal Mobile Unit Eleven, Detachment One (EODMU-1, DET 1), rappels from an SH-60 Seah
militaryaircraft
Defense.gov News Photo 101202-N-0696M-047 - Secretary of Defense Robert M. Gates greets Sen. John McCain prior to testimony before the Senate Armed Services Committee on Dec. 2 2010. Gates
michael g. mullen in 2010testimonial
Senior older person lonely
landscapewater
Snow winter way
landscapetravel
Under the roof room window
furniturewater
Money making finance business
businessmoney
Nature adventure travel
landscapetravel
Wings horn stag
landscapeanimals
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations inAngat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
plantswater
Angat River along Pulilan-Plaridel, Bulacan - Kangkong Ipomoea aquatica Forsk. Convolvulus reptans Linn. fields or plantations in Angat River (in Barangay Lumang Bayan, Plaridel, Bulacan on one side
summergrass
Flag of Suriname (proposal 1)
yellow flagchevron
National Flag of Chinese Soviet Republic
yellow flagcommunism
Flag of Bulgaria (1946-1948)
green and red color combinationself-published work
Flag of Lincoln
self-published worklincoln
Flag of the Saho People's Democratic Movement
self-published workwith insignia
Formula physics school
scienceschool
Hand elegant person
backgroundmale
Girl business beautiful
technologybusiness
Adult hair face
ornamentgirl
Flag of Governor-General of Belgian Congo
with insigniapd-user
Leiden vlag
self-published workone white
Flag Thai Brigadier
self-published workwith insignia
Bandera Provincia El Oro
flags with three vertical stripesself-published work
Flag of the Republic of Pisa
self-published workwith insignia
Alicia and Jane Clarke of Walford Court, Ross-on-Wye, Herefordshire, Arthur Devis, circa 1758
portrait paintings by arthur devisportrait paintings with trees
Mom mother and child mother and son
naturemother
Naval Ensign of Ukraine 1997 (dress)
ukrainenaval
Flag of Mellieħa (1993-2000)
blue and white flagsself-published work
Flag of French Polynesia
yellow flagone white
Heterosexual symbol two hearts
two heartssymbol
William Davenant, John Greenhill, 1673
william davenantjohn greenhill
Flag Revolt of the Tailors
white flagone white
Leiden vlag verticaal
self-published workone white
Flag of Morocco-2005
svg flags with an aspect ratio of 3:2with insignia
Flag of the President of Malta
self-published workwith insignia
Naval Ensign of Latvia
red and white flagnaval
Charles Baugniet16, Charles Baugniet
paintings by charles baugniet19th-century genre paintings
Crown Princess Louise and with one of her daughters, Laurits Tuxen, 1883
louise, crown princess of denmark in 1883christian ix of denmark with his family
Flag of Mari El
self-published workvalid svg
Flag of the Royal Egyptian Air Force (1922-1952)
egyptianegypt
Portrait people caucasian
malegirl
The Knight Errant, John Everett Millais, 1870
the knight errant (john everett millais)pre-raphaelite brotherhood,symbolism
Bandeira Província do Piauí
brazilianone white
Flag of Spain (Civil)
spain flagspain
Portrait of Absalom Jones, Raphaelle Peale, 1810
portrait paintings in the delaware art museumportrait paintings by raphaelle peale
Touch screen screen bookshelf
technologymale
Portrait of George Mason (1725-1792), John Hesselius, 1750
portrait paintings by john hesseliusgeorge mason (statesman)
13201 - 13300 of 51,426 Next page
/ 515