17,364 Free Photos of First

cc-zeronaturevehiclecarlandscapeanimalsskysportblueauto
President Ronald Reagan and Walter Mondale during the presidential debate on foreign policy in Louisville, Kentucky
ronald reagan in 19841984
Player athlete base
activitiessummer
First world war ieper third battle of ypres
naturetree
Zoo madrid bird
animalsbird
Caribou skin coat, Innu, Quebec-Labrador Peninsula, c. 1805 - Royal Ontario Museum - DSC00317
files uploaded by daderotcc-zero
CTV News at Sugar Beach 02
vehiclecar
12.6.11PeterJGanciJrPanelS-17ByLuigiNovi7
self-published workletter
1979_Mowag_AW_100,_22-LPP-1_pic1
vehiclecar
Bow Street Station - First day of Service
pavementtraffic
Osaka Motor Show 2013 (101) Suzuki HUSTLER X
vehiclecar
Model of the First Battleship Wisconsin, built 1896-1901 - Wisconsin Veterans Museum - DSC02956
boatship
Magia Naturalis, by Giovanni Battista Porta, first published 1558, this edition 1644 - National Cryptologic Museum - DSC07744
self-published workcc-zero
First Grief (Little Peasant) by Erastus Dow Palmer, 1859, marble - Albany Institute of History and Art - DSC08257
self-published workerastus dow palmer
The frontview of Suzuki HUSTLER X Turbo (MR31S) exhibited at JR Shin-Osaka Station
vehiclecar
Suzuki Hustler rear - Tokyo Motor Show 2013
vehiclecar
Broom machine - steps necessary in making round broom, first made in 1797 - Hadley Farm Museum - DSC07716
self-published workinterior
Dodge fire engine of the Fire sub-station of Apollonia, Pyrosvestiko klimakio Apollonion, pic3
vehiclecar
Peak panorama the alps
landscapenature
Association blood frog
childrenanimals
Winter outdoor landscape
landscapescenes
Renaissance france spiral staircase
architecturewindow
US Navy 110210-N-SF508-068 Aviation Ordnanceman Airman Bradley Spencer, from Scottsburg, Ind., reads about Dr. Martin Luther King Jr. to first grad
united states navy images from yokosukagroup
US Navy 110514-N-XQ375-374 The guided-missile destroyer USS Truxtun (DDG 103) is underway in the Atlantic Ocean during her first-ever combat deploy
vehiclenavy
US Navy 110810-N-ZB612-266 Chief of Naval Operations (CNO) Adm. Gary Roughead renders honors during a welcoming ceremony at the First Naval Distric
united states navy images from rio de janeirobrazil
US Navy 110913-N-VH839-026 Fire Controlman 3rd Class Matthew Burger, a visit, board, search and seizure (VBSS) first climber aboard the Arleigh Bur
rope ladderblue
US Navy 120111-N-PO203-130 Rear Adm. Matthew L. Klunder, the 24th chief of naval research, discusses his 2012 priorities during his first all-hands
arlington countyvirginia
US Navy 120119-N-GZ832-012 First class petty officers aboard the Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) take the chief petty office
aboard uss carl vinson (cvn-70)
US Navy 120130-N-AC887-001 Secretary of the Navy (SECNAV) the honorable Ray Mabus speaks with a wounded warrior before first lady Michelle Obama de
wounded warriord.c.,
First Lady Betty Ford's beige striped gown
striped dressflower dress
US Navy 081122-N-3289C-208 A Spanish participant completes the first five kilometers of the 10-kilometer foot race during Naval Station Rota's Morale Welfare and Recreations duathlon
naval station rotasport
US Navy 081223-N-7705S-093 Lt. Cmdr Brad Terry embraces his children for the first time in six months after returning to Naval Station Norfolk
naval station norfolkpeople
Fishing cat (Prionailurus viverrinus) at Cincinnati Zoo
animalsmammals
West pier first light coast
landscapetravel
US Navy 100318-N-5366K-209 Navy Counselor 2nd Class Paul Lacey, assigned to Navy Recruiting District Miami, throws out the first pitch at a New York Yankees spring training game at Steinbrenner Field in Tampa, Fla
sidewalkpeople
12.6.11MychalJudgePanelS-18ByLuigiNovi3
nighttimenight
Dodge fire engine of the Fire sub-station of Apollonia, Pyrosvestiko klimakio Apollonion, pic1
vehiclecar
Sama Kindergarten and Elementary School - First day of Iranian new education year - for Kindergarten students and elementary school newcomers - Qods zone(town) - city of Nishapur 076
self-published workcolor
Vase, terre cuite peinte. Gansu. Culture de Xindian. Musée Cernuschi M.C. 2001-19
self-published workcc-zero
President Ronald Reagan attending opening day game of the 1984 Baseball Season
ceremonial first pitch (major league baseball)memorial stadium (baltimore)
Parish symbol alpine
backgroundsymbol
Street food food dish
kitchenfood
Flower plant natural
insectsnature
The night sky sky night
landscapenature
Enter champions rare
celebritiesbackground
Close up flower blossom
animalsnature
Prize cup victory
celebritiesicons
Yorkshire dales sunrise
landscapenature
Ambulance helicopter red red white
helicopteraircraft
Foliation spring yellow green
springtree
Blossom bloom nature
naturetree
Jingle Dance Dress, Day Star First Nation, mid 1900s, view 2, cloth, metal - Glenbow Museum - DSC00868
aboriginal peoples clothing in the glenbow museumself-published work
May 2017 GT vs. UGA baseball - Tucker Maxwell at first
peoplesport
Site of Helsinki's First Church 2
landscapetree
Suzuki HUSTLER X Turbo (MR31S) exhibited at JR Shin-Osaka Station front
vehiclecar
Norwalk First Congregational 014
self-published workarchitecture
NMBS I10-A11 Interior first class
vehiclecar
1991-1992_Mitsubishi_RVR_(N10W)_Minivans_(27-03-2018)_02
vehiclecar
US Navy 111020-N-PM781-010 Tom Hicks, Deputy Assistant Secretary of the Navy for Energy, tests a Chevrolet Volt electric car after accepting the ve
arlington countyvirginia
US Navy 081015-N-0411D-010 Sailors practice firing on paper targets from three yards on the first day of live-firing with the 9mm Beretta Pistol. Sailors train in handgun marksmanship
outsidesky
US Navy 090115-N-2013O-002 First class petty officers take the 2009 chief petty officer advancement exam at Fleet Activities Yokosuka
celebritieslight
US Navy 050629-N-9693M-632 Prospective U.S. Naval Academy Midshipmen receive their first military haircut during Induction day at Alumni Hall in Annapolis, Md
shoppingpeople
US Navy 090903-N-7676W-012 Dr. Sujata Millick, acting director of research, welcomes participants to the Office of Naval Research STEM2Stern forum, the first in a series of dialogues among key stakeholders from the Naval Resear
arlington countyvirginia
US Navy 100628-N-5214S-100 Master Chief Petty Officer of the Navy (MCPON) Rick D. West, speaks to Navy counselors on the first day of the 22nd Navy Counselors Association symposium
naval station norfolkrick d. west
US Navy 100322-N-9818V-267 Assistant Commandant of the Marine Corps Gen. James Amos delivers remarks during the first Department of the Navy Sexual Assault Response Coordinator Summit
military in new orleansjames f. amos in 2010
US Navy 110411-N-JR159-070 Students from Basic Underwater Demolition-SEAL (BUD-s) Class 288 participate in log physical training during First Phase
basic underwater demolitions/sealnaval amphibious base coronado
USAF Chaplain School first emblem
chaplain corps heraldry of the united states armyjewish symbols
Wachtposten auf hoher Warte - CH-BAR - 3238889
landscapemountain
First Lady Betty Ford's colorful chiffon silk gown
1970s dressesflower dress
Even-the-prospect-of-a-five-cent-refund-per-throwaway-aluminum-can-in-oregon-has-not-stopped-littering-entirely-the-state-was-the-first-to-enact-a-law-making-all-cans-and-bottles-returnable-for-a-deposit-051973 4271686355 o
photos by david falconerdocumerica
First Lady Jacqueline Kennedy with Prime Minister Jawaharlal Nehru
jacqueline kennedy onassis in indiajohn kenneth galbraith
Museo Torre di San Martino della Battaglia - affresco 05
torre di san martino della battaglia - frescossiege of venice
Asiatic water buffalo and goats in zoo Tierpark Berlin-Friedrichsfelde, Berlin, Germany.
animalsmammals
Sequence of a buffalo (American bison) galloping. Photos taken by Eadweard Muybridge (died 1904), first published in 1887 at Philadelphia (Animal Locomotion).
animalsmammals
Illustration published with first description of Macroderma gigas, named here as Megaderma gigas, a species of microbat found in Australia. There is a figure depicting a skull of the animal at bottom
animalsmammals
Enter champions rare
celebritiesbackground
Athlete game yard line
maleball
Blooming blossom petals
landscapenature
Association blood frog
childrenanimals
President John F. Kennedy, Chancellor Konrad Adenauer, and First Lady Jacqueline Kennedy (03)
john f. kennedy in 1961konrad adenauer in 1961
Defense.gov News Photo 961202-N-0000O-001
defense.gov news media for december 1996images from united states navy to check
Brieftaube mit Metallhülse am Bein zur Aufnahme der Depesche - CH-BAR - 3238322
peoplecity
U.S. Space Force successfully launches first tactically responsive launch mission 210613-F-XXZZZ-0002
aircraftvehicle
US Navy 050629-N-9693M-184 First day Midshipmen stand at attention while reading Reef Points, the manual for Midshipmen at the United States Naval Academy in Annapolis, Md
united states naval academy induction daysailor suit
US Navy 031003-N-5821W-004 Aircrew Survival Equipmentman 1st Class Ryan Fitzgerald shows a group of first-grade students survival equipment
aircrew survival equipmentmangroup
US Navy 110708-N-PB383-005 The amphibious assault ship USS Bonhomme Richard (LHD 6) transits San Diego bay while heading out to sea for the first t
general views of uss bonhomme richard (lhd-6)
US Navy 110420-N-OV802-074 The Fleet METOC Watchfloor combines and synchronizes maritime and aviation meteorological operations for the first time
naval station norfolkjonathan w. white
US Navy 120111-N-PO203-083 Rear Adm. Matthew L. Klunder, the 24th chief of naval research, discusses his 2012 priorities during his first all-hands
virginiagroup
Sanchi, Bhopal, Madhya Pradesh, India Water buffalos. Place first visited 15.12.1923.
animalswater
US Navy 061027-N-4515N-080 This event was one of many during the first-ever EOD Top-Tech Challenge 2006
waterpond
First Lady Betty Ford's brown gown with ivory cape
1970s dressesbrown dress
Lynda Bird Johnson with the President
lyndon b. johnson in 1967fashion in 1967
Forest landscape switzerland
landscapetravel
Renaissance france pilasters
architecturetravel
Blue arabs sky
landscapeskyline
Closeup living nature beautiful flower
naturespring
12.6.11WilsonFlaggPanelS-70ByLuigiNovi1
american airlines flight 77self-published work
First Chinese-American Boy Scout troop
self-published workpd text
Madrid - Iglesia del Primer Convento de la Visitación (Salesas Reales) 14
architecturegold
Madrid - Iglesia del Primer Convento de la Visitación (Salesas Reales) 11
self-published workcc-zero
May 2017 GT vs. UGA baseball - Chase Murray at first
peoplesport
3501 - 3600 of 17,364 Next page
/ 174